SMARCD3 monoclonal antibody (M01), clone 1G6 View larger

SMARCD3 monoclonal antibody (M01), clone 1G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCD3 monoclonal antibody (M01), clone 1G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about SMARCD3 monoclonal antibody (M01), clone 1G6

Brand: Abnova
Reference: H00006604-M01
Product name: SMARCD3 monoclonal antibody (M01), clone 1G6
Product description: Mouse monoclonal antibody raised against a partial recombinant SMARCD3.
Clone: 1G6
Isotype: IgG2a Kappa
Gene id: 6604
Gene name: SMARCD3
Gene alias: BAF60C|CRACD3|MGC111010|Rsc6p
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Genbank accession: NM_001003801
Immunogen: SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT
Protein accession: NP_001003801
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006604-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006604-M01-1-9-1.jpg
Application image note: SMARCD3 monoclonal antibody (M01), clone 1G6 Western Blot analysis of SMARCD3 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: The core component of the mammalian SWI/SNF complex SMARCD3/BAF60c is a coactivator for the nuclear retinoic acid receptor.Flajollet S, Lefebvre B, Cudejko C, Staels B, Lefebvre P.
Mol Cell Endocrinol. 2007 May 30;270(1-2):23-32. Epub 2007 Feb 15.

Reviews

Buy SMARCD3 monoclonal antibody (M01), clone 1G6 now

Add to cart