Brand: | Abnova |
Reference: | H00006603-M01 |
Product name: | SMARCD2 monoclonal antibody (M01), clone 2F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SMARCD2. |
Clone: | 2F7 |
Isotype: | IgG2a Kappa |
Gene id: | 6603 |
Gene name: | SMARCD2 |
Gene alias: | BAF60B|CRACD2|PRO2451|Rsc6p |
Gene description: | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 |
Genbank accession: | NM_003077 |
Immunogen: | SMARCD2 (NP_003068, 398 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL |
Protein accession: | NP_003068 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to SMARCD2 on formalin-fixed paraffin-embedded human breast. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |