SMARCD2 monoclonal antibody (M01), clone 2F7 View larger

SMARCD2 monoclonal antibody (M01), clone 2F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCD2 monoclonal antibody (M01), clone 2F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about SMARCD2 monoclonal antibody (M01), clone 2F7

Brand: Abnova
Reference: H00006603-M01
Product name: SMARCD2 monoclonal antibody (M01), clone 2F7
Product description: Mouse monoclonal antibody raised against a partial recombinant SMARCD2.
Clone: 2F7
Isotype: IgG2a Kappa
Gene id: 6603
Gene name: SMARCD2
Gene alias: BAF60B|CRACD2|PRO2451|Rsc6p
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Genbank accession: NM_003077
Immunogen: SMARCD2 (NP_003068, 398 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL
Protein accession: NP_003068
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006603-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006603-M01-3-42-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SMARCD2 on formalin-fixed paraffin-embedded human breast. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMARCD2 monoclonal antibody (M01), clone 2F7 now

Add to cart