SMARCB1 monoclonal antibody (M14), clone 2H1 View larger

SMARCB1 monoclonal antibody (M14), clone 2H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCB1 monoclonal antibody (M14), clone 2H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SMARCB1 monoclonal antibody (M14), clone 2H1

Brand: Abnova
Reference: H00006598-M14
Product name: SMARCB1 monoclonal antibody (M14), clone 2H1
Product description: Mouse monoclonal antibody raised against a full-length recombinant SMARCB1.
Clone: 2H1
Isotype: IgG2b Kappa
Gene id: 6598
Gene name: SMARCB1
Gene alias: BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Genbank accession: NM_002931
Immunogen: SMARCB1 (NP_002922, 123 a.a. ~ 202 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNE
Protein accession: NP_002922
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006598-M14-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.80 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006598-M14-1-19-1.jpg
Application image note: SMARCB1 monoclonal antibody (M14), clone 2H1. Western Blot analysis of SMARCB1 expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMARCB1 monoclonal antibody (M14), clone 2H1 now

Add to cart