SMARCB1 monoclonal antibody (M01), clone 3E10 View larger

SMARCB1 monoclonal antibody (M01), clone 3E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCB1 monoclonal antibody (M01), clone 3E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about SMARCB1 monoclonal antibody (M01), clone 3E10

Brand: Abnova
Reference: H00006598-M01
Product name: SMARCB1 monoclonal antibody (M01), clone 3E10
Product description: Mouse monoclonal antibody raised against a partial recombinant SMARCB1.
Clone: 3E10
Isotype: IgG1 Kappa
Gene id: 6598
Gene name: SMARCB1
Gene alias: BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Genbank accession: NM_003073
Immunogen: SMARCB1 (NP_003064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA
Protein accession: NP_003064
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006598-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00006598-M01-3-12-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SMARCB1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: IGFBP7 Is Not Required for B-RAF-Induced Melanocyte Senescence.Scurr LL, Pupo GM, Becker TM, Lai K, Schrama D, Haferkamp S, Irvine M, Scolyer RA, Mann GJ, Becker JC, Kefford RF, Rizos H.
Cell. 2010 May 14;141(4):717-27.

Reviews

Buy SMARCB1 monoclonal antibody (M01), clone 3E10 now

Add to cart