SNAI2 monoclonal antibody (M21), clone 3G9 View larger

SNAI2 monoclonal antibody (M21), clone 3G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAI2 monoclonal antibody (M21), clone 3G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SNAI2 monoclonal antibody (M21), clone 3G9

Brand: Abnova
Reference: H00006591-M21
Product name: SNAI2 monoclonal antibody (M21), clone 3G9
Product description: Mouse monoclonal antibody raised against a partial recombinant SNAI2.
Clone: 3G9
Isotype: IgG2a Kappa
Gene id: 6591
Gene name: SNAI2
Gene alias: MGC10182|SLUG|SLUGH1|WS2D
Gene description: snail homolog 2 (Drosophila)
Genbank accession: BC014890
Immunogen: SNAI2 (AAH14890, 69 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCN
Protein accession: AAH14890
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006591-M21-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SNAI2 monoclonal antibody (M21), clone 3G9 now

Add to cart