Brand: | Abnova |
Reference: | H00006591-M07 |
Product name: | SNAI2 monoclonal antibody (M07), clone 2E10 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SNAI2. |
Clone: | 2E10 |
Isotype: | IgG2a Kappa |
Gene id: | 6591 |
Gene name: | SNAI2 |
Gene alias: | MGC10182|SLUG|SLUGH1|WS2D |
Gene description: | snail homolog 2 (Drosophila) |
Genbank accession: | NM_003068 |
Immunogen: | SNAI2 (NP_003059, 69 a.a. ~ 132 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCN |
Protein accession: | NP_003059 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.78 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SNAI2 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |
Publications: | Endosomal sorting by Semaphorin 4A in retinal pigment epithelium supports photoreceptor survival.Toyofuku T, Nojima S, Ishikawa T, Takamatsu H, Tsujimura T, Uemura A, Matsuda J, Seki T, Kumanogoh A. Genes Dev. 2012 Apr 15;26(8):816-29. Epub 2012 Mar 30. |