SNAI2 monoclonal antibody (M07), clone 2E10 View larger

SNAI2 monoclonal antibody (M07), clone 2E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAI2 monoclonal antibody (M07), clone 2E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SNAI2 monoclonal antibody (M07), clone 2E10

Brand: Abnova
Reference: H00006591-M07
Product name: SNAI2 monoclonal antibody (M07), clone 2E10
Product description: Mouse monoclonal antibody raised against a full-length recombinant SNAI2.
Clone: 2E10
Isotype: IgG2a Kappa
Gene id: 6591
Gene name: SNAI2
Gene alias: MGC10182|SLUG|SLUGH1|WS2D
Gene description: snail homolog 2 (Drosophila)
Genbank accession: NM_003068
Immunogen: SNAI2 (NP_003059, 69 a.a. ~ 132 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCN
Protein accession: NP_003059
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006591-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006591-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SNAI2 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice
Publications: Endosomal sorting by Semaphorin 4A in retinal pigment epithelium supports photoreceptor survival.Toyofuku T, Nojima S, Ishikawa T, Takamatsu H, Tsujimura T, Uemura A, Matsuda J, Seki T, Kumanogoh A.
Genes Dev. 2012 Apr 15;26(8):816-29. Epub 2012 Mar 30.

Reviews

Buy SNAI2 monoclonal antibody (M07), clone 2E10 now

Add to cart