SNAI2 monoclonal antibody (M06), clone 3F4 View larger

SNAI2 monoclonal antibody (M06), clone 3F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAI2 monoclonal antibody (M06), clone 3F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about SNAI2 monoclonal antibody (M06), clone 3F4

Brand: Abnova
Reference: H00006591-M06
Product name: SNAI2 monoclonal antibody (M06), clone 3F4
Product description: Mouse monoclonal antibody raised against a full-length recombinant SNAI2.
Clone: 3F4
Isotype: IgG2a Kappa
Gene id: 6591
Gene name: SNAI2
Gene alias: MGC10182|SLUG|SLUGH1|WS2D
Gene description: snail homolog 2 (Drosophila)
Genbank accession: NM_003068
Immunogen: SNAI2 (NP_003059, 69 a.a. ~ 132 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCN
Protein accession: NP_003059
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy SNAI2 monoclonal antibody (M06), clone 3F4 now

Add to cart