Brand: | Abnova |
Reference: | H00006591-M05 |
Product name: | SNAI2 monoclonal antibody (M05), clone 3C12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SNAI2. |
Clone: | 3C12 |
Isotype: | IgG3 Kappa |
Gene id: | 6591 |
Gene name: | SNAI2 |
Gene alias: | MGC10182|SLUG|SLUGH1|WS2D |
Gene description: | snail homolog 2 (Drosophila) |
Genbank accession: | NM_003068 |
Immunogen: | SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV |
Protein accession: | NP_003059 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in human liver. |
Applications: | WB-Ce,WB-Ti,IF,ELISA,WB-Re,IF-CTC |
Shipping condition: | Dry Ice |