SNAI2 monoclonal antibody (M05), clone 3C12 View larger

SNAI2 monoclonal antibody (M05), clone 3C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAI2 monoclonal antibody (M05), clone 3C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,IF,ELISA,WB-Re,IF-CTC

More info about SNAI2 monoclonal antibody (M05), clone 3C12

Brand: Abnova
Reference: H00006591-M05
Product name: SNAI2 monoclonal antibody (M05), clone 3C12
Product description: Mouse monoclonal antibody raised against a partial recombinant SNAI2.
Clone: 3C12
Isotype: IgG3 Kappa
Gene id: 6591
Gene name: SNAI2
Gene alias: MGC10182|SLUG|SLUGH1|WS2D
Gene description: snail homolog 2 (Drosophila)
Genbank accession: NM_003068
Immunogen: SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
Protein accession: NP_003059
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006591-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.77 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00006591-M05-2-A1-1.jpg
Application image note: SNAI2 monoclonal antibody (M05), clone 3C12. Western Blot analysis of SNAI2 expression in human liver.
Applications: WB-Ce,WB-Ti,IF,ELISA,WB-Re,IF-CTC
Shipping condition: Dry Ice

Reviews

Buy SNAI2 monoclonal antibody (M05), clone 3C12 now

Add to cart