SNAI2 monoclonal antibody (M04), clone 4D11 View larger

SNAI2 monoclonal antibody (M04), clone 4D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAI2 monoclonal antibody (M04), clone 4D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about SNAI2 monoclonal antibody (M04), clone 4D11

Brand: Abnova
Reference: H00006591-M04
Product name: SNAI2 monoclonal antibody (M04), clone 4D11
Product description: Mouse monoclonal antibody raised against a partial recombinant SNAI2.
Clone: 4D11
Isotype: IgG1 Kappa
Gene id: 6591
Gene name: SNAI2
Gene alias: MGC10182|SLUG|SLUGH1|WS2D
Gene description: snail homolog 2 (Drosophila)
Genbank accession: NM_003068
Immunogen: SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
Protein accession: NP_003059
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006591-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.77 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006591-M04-1-25-1.jpg
Application image note: SNAI2 monoclonal antibody (M04), clone 4D11 Western Blot analysis of SNAI2 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: A novel long non-coding RNA linc-ZNF469-3 promotes lung metastasis through miR-574-5p-ZEB1 axis in triple negative breast cancer.Wang PS, Chou CH, Lin CH, Yao YC, Cheng HC, Li HY, Chuang YC, Yang CN, Ger LP, Chen YC, Lin FC, Shen TL, Hsiao M, Lu PJ.
Oncogene. 2018 May 14. [Epub ahead of print]

Reviews

Buy SNAI2 monoclonal antibody (M04), clone 4D11 now

Add to cart