Brand: | Abnova |
Reference: | H00006591-M04 |
Product name: | SNAI2 monoclonal antibody (M04), clone 4D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SNAI2. |
Clone: | 4D11 |
Isotype: | IgG1 Kappa |
Gene id: | 6591 |
Gene name: | SNAI2 |
Gene alias: | MGC10182|SLUG|SLUGH1|WS2D |
Gene description: | snail homolog 2 (Drosophila) |
Genbank accession: | NM_003068 |
Immunogen: | SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV |
Protein accession: | NP_003059 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SNAI2 monoclonal antibody (M04), clone 4D11 Western Blot analysis of SNAI2 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | A novel long non-coding RNA linc-ZNF469-3 promotes lung metastasis through miR-574-5p-ZEB1 axis in triple negative breast cancer.Wang PS, Chou CH, Lin CH, Yao YC, Cheng HC, Li HY, Chuang YC, Yang CN, Ger LP, Chen YC, Lin FC, Shen TL, Hsiao M, Lu PJ. Oncogene. 2018 May 14. [Epub ahead of print] |