Brand: | Abnova |
Reference: | H00006591-A01 |
Product name: | SNAI2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SNAI2. |
Gene id: | 6591 |
Gene name: | SNAI2 |
Gene alias: | MGC10182|SLUG|SLUGH1|WS2D |
Gene description: | snail homolog 2 (Drosophila) |
Genbank accession: | NM_003068 |
Immunogen: | SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV |
Protein accession: | NP_003059 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00006591-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00006591-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (34.14 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |