SLPI monoclonal antibody (M01), clone 3C6 View larger

SLPI monoclonal antibody (M01), clone 3C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLPI monoclonal antibody (M01), clone 3C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SLPI monoclonal antibody (M01), clone 3C6

Brand: Abnova
Reference: H00006590-M01
Product name: SLPI monoclonal antibody (M01), clone 3C6
Product description: Mouse monoclonal antibody raised against a partial recombinant SLPI.
Clone: 3C6
Isotype: IgG2a Kappa
Gene id: 6590
Gene name: SLPI
Gene alias: ALK1|ALP|BLPI|HUSI|HUSI-I|MPI|WAP4|WFDC4
Gene description: secretory leukocyte peptidase inhibitor
Genbank accession: NM_003064
Immunogen: SLPI (NP_003055, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
Protein accession: NP_003055
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006590-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006590-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SLPI is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SLPI monoclonal antibody (M01), clone 3C6 now

Add to cart