Brand: | Abnova |
Reference: | H00006583-M01 |
Product name: | SLC22A4 monoclonal antibody (M01), clone 2D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC22A4. |
Clone: | 2D3 |
Isotype: | IgG1 Kappa |
Gene id: | 6583 |
Gene name: | SLC22A4 |
Gene alias: | MGC34546|MGC40524|OCTN1 |
Gene description: | solute carrier family 22 (organic cation/ergothioneine transporter), member 4 |
Genbank accession: | NM_003059 |
Immunogen: | SLC22A4 (NP_003050, 43 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK |
Protein accession: | NP_003050 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC22A4 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |