SLC22A4 monoclonal antibody (M01), clone 2D3 View larger

SLC22A4 monoclonal antibody (M01), clone 2D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC22A4 monoclonal antibody (M01), clone 2D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SLC22A4 monoclonal antibody (M01), clone 2D3

Brand: Abnova
Reference: H00006583-M01
Product name: SLC22A4 monoclonal antibody (M01), clone 2D3
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC22A4.
Clone: 2D3
Isotype: IgG1 Kappa
Gene id: 6583
Gene name: SLC22A4
Gene alias: MGC34546|MGC40524|OCTN1
Gene description: solute carrier family 22 (organic cation/ergothioneine transporter), member 4
Genbank accession: NM_003059
Immunogen: SLC22A4 (NP_003050, 43 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
Protein accession: NP_003050
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006583-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC22A4 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SLC22A4 monoclonal antibody (M01), clone 2D3 now

Add to cart