Brand: | Abnova |
Reference: | H00006582-M02 |
Product name: | SLC22A2 monoclonal antibody (M02), clone 1E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC22A2. |
Clone: | 1E3 |
Isotype: | IgG2a Kappa |
Gene id: | 6582 |
Gene name: | SLC22A2 |
Gene alias: | MGC32628|OCT2 |
Gene description: | solute carrier family 22 (organic cation transporter), member 2 |
Genbank accession: | BC039899 |
Immunogen: | SLC22A2 (AAH39899, 261 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HWRWLQFTVALPNFFFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSVLYQGLIKHMG |
Protein accession: | AAH39899 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC22A2 is 0.3 ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |