SLC22A3 polyclonal antibody (A01) View larger

SLC22A3 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC22A3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SLC22A3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006581-A01
Product name: SLC22A3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
Gene id: 6581
Gene name: SLC22A3
Gene alias: EMT|EMTH|OCT3
Gene description: solute carrier family 22 (extraneuronal monoamine transporter), member 3
Genbank accession: NM_021977
Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 155 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD
Protein accession: NP_068812
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006581-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC22A3 polyclonal antibody (A01) now

Add to cart