Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLCO2A1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about SLCO2A1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00006578-A01 |
| Product name: | SLCO2A1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SLCO2A1. |
| Gene id: | 6578 |
| Gene name: | SLCO2A1 |
| Gene alias: | OATP2A1|PGT|SLC21A2 |
| Gene description: | solute carrier organic anion transporter family, member 2A1 |
| Genbank accession: | NM_005630 |
| Immunogen: | SLCO2A1 (NP_005621, 276 a.a. ~ 325 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FFFPRAMPIGAKRAPATADEARKLEEAKSRGSLVDFIKRFPCIFLRLLMN |
| Protein accession: | NP_005621 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.61 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SLCO2A1 polyclonal antibody (A01), Lot # 060529JCS1 Western Blot analysis of SLCO2A1 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Reduction of prostaglandin transporter predicts poor prognosis associated with angiogenesis in gastric adenocarcinoma.Takeda S, Tanigawa T, Watanabe T, Tatsuwaki H, Nadatani Y, Otani K, Nagami Y, Tanaka F, Kamata N, Yamagami H, Shiba M, Tominaga K, Fujiwara Y, Muguruma K, Ohira M, Hirakawa K, Arakawa T. J Gastroenterol Hepatol. 2015 Aug 6. [Epub ahead of print] |