Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC20A2 monoclonal antibody (M04), clone 4B1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about SLC20A2 monoclonal antibody (M04), clone 4B1
| Brand: | Abnova |
| Reference: | H00006575-M04 |
| Product name: | SLC20A2 monoclonal antibody (M04), clone 4B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC20A2. |
| Clone: | 4B1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6575 |
| Gene name: | SLC20A2 |
| Gene alias: | GLVR2|Glvr-2|MLVAR|PIT-2 |
| Gene description: | solute carrier family 20 (phosphate transporter), member 2 |
| Genbank accession: | NM_006749 |
| Immunogen: | SLC20A2 (NP_006740.1, 243 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEGTSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGH |
| Protein accession: | NP_006740.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLC20A2 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Localization of type-III sodium-dependent phosphate transporter 2 in the mouse brain.Inden M, Iriyama M, Takagi M, Kaneko M, Hozumi I Brain Res. 2013 Jul 30. pii: S0006-8993(13)01046-9. doi: 10.1016/j.brainres.2013.07.038. |