SLC18A2 polyclonal antibody (A01) View larger

SLC18A2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC18A2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SLC18A2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006571-A01
Product name: SLC18A2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SLC18A2.
Gene id: 6571
Gene name: SLC18A2
Gene alias: MGC120477|MGC120478|MGC26538|SVAT|SVMT|VAT2|VMAT2
Gene description: solute carrier family 18 (vesicular monoamine), member 2
Genbank accession: NM_003054
Immunogen: SLC18A2 (NP_003045, 53 a.a. ~ 151 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: HEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGL
Protein accession: NP_003045
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006571-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006571-A01-1-6-1.jpg
Application image note: SLC18A2 polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of SLC18A2 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC18A2 polyclonal antibody (A01) now

Add to cart