SLC12A2 monoclonal antibody (M01), clone 5H7 View larger

SLC12A2 monoclonal antibody (M01), clone 5H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC12A2 monoclonal antibody (M01), clone 5H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about SLC12A2 monoclonal antibody (M01), clone 5H7

Brand: Abnova
Reference: H00006558-M01
Product name: SLC12A2 monoclonal antibody (M01), clone 5H7
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC12A2.
Clone: 5H7
Isotype: IgG2b Kappa
Gene id: 6558
Gene name: SLC12A2
Gene alias: BSC|BSC2|MGC104233|NKCC1
Gene description: solute carrier family 12 (sodium/potassium/chloride transporters), member 2
Genbank accession: NM_001046
Immunogen: SLC12A2 (NP_001037.1, 903 a.a. ~ 1010 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLE
Protein accession: NP_001037.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006558-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006558-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to SLC12A2 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC12A2 monoclonal antibody (M01), clone 5H7 now

Add to cart