Brand: | Abnova |
Reference: | H00006558-M01 |
Product name: | SLC12A2 monoclonal antibody (M01), clone 5H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC12A2. |
Clone: | 5H7 |
Isotype: | IgG2b Kappa |
Gene id: | 6558 |
Gene name: | SLC12A2 |
Gene alias: | BSC|BSC2|MGC104233|NKCC1 |
Gene description: | solute carrier family 12 (sodium/potassium/chloride transporters), member 2 |
Genbank accession: | NM_001046 |
Immunogen: | SLC12A2 (NP_001037.1, 903 a.a. ~ 1010 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLE |
Protein accession: | NP_001037.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to SLC12A2 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |