SLC11A1 monoclonal antibody (M01), clone 2G2 View larger

SLC11A1 monoclonal antibody (M01), clone 2G2

H00006556-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC11A1 monoclonal antibody (M01), clone 2G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re

More info about SLC11A1 monoclonal antibody (M01), clone 2G2

Brand: Abnova
Reference: H00006556-M01
Product name: SLC11A1 monoclonal antibody (M01), clone 2G2
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC11A1.
Clone: 2G2
Isotype: IgG1 Kappa
Gene id: 6556
Gene name: SLC11A1
Gene alias: LSH|NRAMP|NRAMP1
Gene description: solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1
Genbank accession: NM_000578
Immunogen: SLC11A1 (NP_000569.2, 308 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV
Protein accession: NP_000569.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006556-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (30.47 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006556-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC11A1 is approximately 0.03ng/ml as a capture antibody.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Solute Carrier 11A1 Is Expressed by Innate Lymphocytes and Augments Their Activation.Hedges JF, Kimmel E, Snyder DT, Jerome M, Jutila MA
J Immunol. 2013 Apr 15;190(8):4263-73. doi: 10.4049/jimmunol.1200732. Epub 2013 Mar 18.

Reviews

Buy SLC11A1 monoclonal antibody (M01), clone 2G2 now

Add to cart