SLC10A1 (Human) Recombinant Protein View larger

SLC10A1 (Human) Recombinant Protein

H00006554-G01_10ug

New product

569,00 € tax excl.

10 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC10A1 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP

More info about SLC10A1 (Human) Recombinant Protein

Brand: Abnova
Reference: H00006554-G01
Product name: SLC10A1 (Human) Recombinant Protein
Product description: Human SLC10A1 full-length ORF (ADR82943.1) recombinant protein without tag.
Gene id: 6554
Gene name: SLC10A1
Gene alias: NTCP|NTCP1
Gene description: solute carrier family 10 (sodium/bile acid cotransporter family), member 1
Genbank accession: HQ258189.1
Immunogen sequence/protein sequence: MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
Protein accession: ADR82943.1
Form: Liquid
Preparation method: in vitro wheat germ expression system with proprietary liposome technology
Recommend dilutions: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note: Best use within three months from the date of receipt of this protein.
Tag: None
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP
Shipping condition: Dry Ice

Reviews

Buy SLC10A1 (Human) Recombinant Protein now

Add to cart