Brand: | Abnova |
Reference: | H00006541-M02 |
Product name: | SLC7A1 monoclonal antibody (M02), clone 2B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC7A1. |
Clone: | 2B9 |
Isotype: | IgG1 Kappa |
Gene id: | 6541 |
Gene name: | SLC7A1 |
Gene alias: | ATRC1|CAT-1|ERR|HCAT1|REC1L |
Gene description: | solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 |
Genbank accession: | NM_003045 |
Immunogen: | SLC7A1 (NP_003036, 431 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS |
Protein accession: | NP_003036 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC7A1 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |