SLC6A4 polyclonal antibody (A01) View larger

SLC6A4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC6A4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SLC6A4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006532-A01
Product name: SLC6A4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SLC6A4.
Gene id: 6532
Gene name: SLC6A4
Gene alias: 5-HTT|5HTT|HTT|OCD1|SERT|hSERT
Gene description: solute carrier family 6 (neurotransmitter transporter, serotonin), member 4
Genbank accession: NM_001045
Immunogen: SLC6A4 (NP_001036, 181 a.a. ~ 252 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGIS
Protein accession: NP_001036
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006532-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.03 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC6A4 polyclonal antibody (A01) now

Add to cart