SLC4A1 (Human) Recombinant Protein (Q01) View larger

SLC4A1 (Human) Recombinant Protein (Q01)

New product

527,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC4A1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about SLC4A1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00006521-Q01
Product name: SLC4A1 (Human) Recombinant Protein (Q01)
Product description: Human SLC4A1 partial ORF ( NP_000333.1, 261 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 6521
Gene name: SLC4A1
Gene alias: AE1|BND3|CD233|DI|EMPB3|EPB3|FR|MGC116750|MGC116753|MGC126619|MGC126623|RTA1A|SW|WD|WD1|WR
Gene description: solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)
Genbank accession: NM_000342
Immunogen sequence/protein sequence: PIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK
Protein accession: NP_000333.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00006521-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC4A1 (Human) Recombinant Protein (Q01) now

Add to cart