Brand: | Abnova |
Reference: | H00006519-A01 |
Product name: | SLC3A1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SLC3A1. |
Gene id: | 6519 |
Gene name: | SLC3A1 |
Gene alias: | ATR1|CSNU1|D2H|FLJ34681|NBAT|RBAT |
Gene description: | solute carrier family 3 (cystine, dibasic and neutral amino acid transporters, activator of cystine, dibasic and neutral amino acid transport), member 1 |
Genbank accession: | BC022386 |
Immunogen: | SLC3A1 (AAH22386, 211 a.a. ~ 320 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | FIPNHTSDKHIWFQLSRTRTGKYTDYYIWHDCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEILRFWLTKGVDGFSLDAVKFLL |
Protein accession: | AAH22386 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |