Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC2A4 monoclonal antibody (M10), clone 1G9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about SLC2A4 monoclonal antibody (M10), clone 1G9
| Brand: | Abnova |
| Reference: | H00006517-M10 |
| Product name: | SLC2A4 monoclonal antibody (M10), clone 1G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC2A4. |
| Clone: | 1G9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6517 |
| Gene name: | SLC2A4 |
| Gene alias: | GLUT4 |
| Gene description: | solute carrier family 2 (facilitated glucose transporter), member 4 |
| Genbank accession: | NM_001042 |
| Immunogen: | SLC2A4 (NP_001033, 467 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND |
| Protein accession: | NP_001033 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (30.47 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLC2A4 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |