SLC1A6 monoclonal antibody (M01), clone 6D9 View larger

SLC1A6 monoclonal antibody (M01), clone 6D9

H00006511-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC1A6 monoclonal antibody (M01), clone 6D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SLC1A6 monoclonal antibody (M01), clone 6D9

Brand: Abnova
Reference: H00006511-M01
Product name: SLC1A6 monoclonal antibody (M01), clone 6D9
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC1A6.
Clone: 6D9
Isotype: IgG1 Kappa
Gene id: 6511
Gene name: SLC1A6
Gene alias: EAAT4|MGC33092|MGC43671
Gene description: solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
Genbank accession: NM_005071
Immunogen: SLC1A6 (NP_005062, 500 a.a. ~ 564 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLGKPYKSLMAQEKGASRGRGGNESAM
Protein accession: NP_005062
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006511-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC1A6 monoclonal antibody (M01), clone 6D9 now

Add to cart