Brand: | Abnova |
Reference: | H00006507-M07A |
Product name: | SLC1A3 monoclonal antibody (M07A), clone 3D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC1A3. |
Clone: | 3D1 |
Isotype: | IgM Kappa |
Gene id: | 6507 |
Gene name: | SLC1A3 |
Gene alias: | EA6|EAAT1|FLJ25094|GLAST|GLAST1 |
Gene description: | solute carrier family 1 (glial high affinity glutamate transporter), member 3 |
Genbank accession: | NM_004172 |
Immunogen: | SLC1A3 (NP_004163.2, 162 a.a. ~ 237 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGS |
Protein accession: | NP_004163.2 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Involvement of Crosstalk between Oct4 and Meis1a in Neural Cell Fate Decision.Yamada T, Urano-Tashiro Y, Tanaka S, Akiyama H, Tashiro F PLoS One. 2013;8(2):e56997. doi: 10.1371/journal.pone.0056997. Epub 2013 Feb 25. |