ST3GAL2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

ST3GAL2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ST3GAL2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti

More info about ST3GAL2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00006483-D01P
Product name: ST3GAL2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human ST3GAL2 protein.
Gene id: 6483
Gene name: ST3GAL2
Gene alias: Gal-NAc6S|SIAT4B|ST3GALII|ST3GalA.2
Gene description: ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Genbank accession: NM_006927.2
Immunogen: ST3GAL2 (NP_008858.1, 1 a.a. ~ 350 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
Protein accession: NP_008858.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00006483-D01P-2-A0-1.jpg
Application image note: ST3GAL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of ST3GAL2 expression in human kidney.
Applications: WB-Ti
Shipping condition: Dry Ice

Reviews

Buy ST3GAL2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart