SIAH1 monoclonal antibody (M02), clone 2C5 View larger

SIAH1 monoclonal antibody (M02), clone 2C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SIAH1 monoclonal antibody (M02), clone 2C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SIAH1 monoclonal antibody (M02), clone 2C5

Brand: Abnova
Reference: H00006477-M02
Product name: SIAH1 monoclonal antibody (M02), clone 2C5
Product description: Mouse monoclonal antibody raised against a partial recombinant SIAH1.
Clone: 2C5
Isotype: IgG1 Kappa
Gene id: 6477
Gene name: SIAH1
Gene alias: FLJ08065|HUMSIAH|Siah-1|Siah-1a|hSIAH1
Gene description: seven in absentia homolog 1 (Drosophila)
Genbank accession: NM_003031
Immunogen: SIAH1 (NP_003022, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLP
Protein accession: NP_003022
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006477-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006477-M02-1-6-1.jpg
Application image note: SIAH1 monoclonal antibody (M02), clone 2C5. Western Blot analysis of SIAH1 expression in Jurkat(Cat # L017V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SIAH1 monoclonal antibody (M02), clone 2C5 now

Add to cart