Brand: | Abnova |
Reference: | H00006477-M02 |
Product name: | SIAH1 monoclonal antibody (M02), clone 2C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SIAH1. |
Clone: | 2C5 |
Isotype: | IgG1 Kappa |
Gene id: | 6477 |
Gene name: | SIAH1 |
Gene alias: | FLJ08065|HUMSIAH|Siah-1|Siah-1a|hSIAH1 |
Gene description: | seven in absentia homolog 1 (Drosophila) |
Genbank accession: | NM_003031 |
Immunogen: | SIAH1 (NP_003022, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLP |
Protein accession: | NP_003022 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SIAH1 monoclonal antibody (M02), clone 2C5. Western Blot analysis of SIAH1 expression in Jurkat(Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |