Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SHMT1 monoclonal antibody (M01), clone 4F9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SHMT1 monoclonal antibody (M01), clone 4F9
| Brand: | Abnova |
| Reference: | H00006470-M01 |
| Product name: | SHMT1 monoclonal antibody (M01), clone 4F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SHMT1. |
| Clone: | 4F9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6470 |
| Gene name: | SHMT1 |
| Gene alias: | CSHMT|MGC15229|MGC24556|SHMT |
| Gene description: | serine hydroxymethyltransferase 1 (soluble) |
| Genbank accession: | NM_004169 |
| Immunogen: | SHMT1 (NP_004160, 374 a.a. ~ 482 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPD |
| Protein accession: | NP_004160 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SHMT1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Mass Spectrometric/Bioinformatic Identification of a Protein Subset That Characterizes the Cellular Activity of Anticancer Peptides.Genovese F, Gualandi A, Taddia L, Marverti G, Pirondi S, Marraccini C, Perco P, Pela M, Guerrini R, Amoroso MR, Esposito F, Martello A, Ponterini G J Proteome Res. 2014 Sep 29. |