Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SHB monoclonal antibody (M07), clone 4C11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
More info about SHB monoclonal antibody (M07), clone 4C11
| Brand: | Abnova |
| Reference: | H00006461-M07 |
| Product name: | SHB monoclonal antibody (M07), clone 4C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SHB. |
| Clone: | 4C11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6461 |
| Gene name: | SHB |
| Gene alias: | RP11-3J10.8|bA3J10.2 |
| Gene description: | Src homology 2 domain containing adaptor protein B |
| Genbank accession: | NM_003028.2 |
| Immunogen: | SHB (NP_003019.2, 348 a.a. ~ 446 a.a) partial recombinant protein with GST-pstS1 tag. |
| Immunogen sequence/protein sequence: | GKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTSPALAAQFNGNEK |
| Protein accession: | NP_003019.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | SHB monoclonal antibody (M07), clone 4C11. Western Blot analysis of SHB expression in human kidney. |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |