Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SH3BP2 monoclonal antibody (M01), clone 1E9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about SH3BP2 monoclonal antibody (M01), clone 1E9
| Brand: | Abnova |
| Reference: | H00006452-M01 |
| Product name: | SH3BP2 monoclonal antibody (M01), clone 1E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SH3BP2. |
| Clone: | 1E9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6452 |
| Gene name: | SH3BP2 |
| Gene alias: | 3BP2|CRBM|CRPM|FLJ42079|RES4-23 |
| Gene description: | SH3-domain binding protein 2 |
| Genbank accession: | BC022996 |
| Immunogen: | SH3BP2 (AAH22996, 452 a.a. ~ 561 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPR |
| Protein accession: | AAH22996 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to SH3BP2 on A-431 cell. [antibody concentration 20 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Reciprocal stabilization of ABL and TAZ regulates osteoblastogenesis through transcription factor RUNX2.Matsumoto Y, La Rose J, Kent OA, Wagner MJ, Narimatsu M, Levy AD, Omar MH, Tong J, Krieger JR, Riggs E, Storozhuk Y, Pasquale J, Ventura M, Yeganeh B, Post M, Moran MF, Grynpas MD, Wrana JL, Superti-Furga G, Koleske AJ, Pendergast AM, Rottapel R. J Clin Invest. 2016 Dec 1;126(12):4482-4496. Epub 2016 Oct 31. J Clin Invest. 2016 Dec 1;126(12):4482-4496. doi: 10.1172/JCI87802. Epub 2016 Oct 31. |