Brand: | Abnova |
Reference: | H00006449-M06 |
Product name: | SGTA monoclonal antibody (M06), clone 2E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SGTA. |
Clone: | 2E11 |
Isotype: | IgG2b Kappa |
Gene id: | 6449 |
Gene name: | SGTA |
Gene alias: | SGT|alphaSGT|hSGT |
Gene description: | small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha |
Genbank accession: | NM_003021 |
Immunogen: | SGTA (NP_003012.1, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPA |
Protein accession: | NP_003012.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to SGTA on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | IF,S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |