Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SGTA monoclonal antibody (M06), clone 2E11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,IP |
More info about SGTA monoclonal antibody (M06), clone 2E11
| Brand: | Abnova |
| Reference: | H00006449-M06 |
| Product name: | SGTA monoclonal antibody (M06), clone 2E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SGTA. |
| Clone: | 2E11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6449 |
| Gene name: | SGTA |
| Gene alias: | SGT|alphaSGT|hSGT |
| Gene description: | small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha |
| Genbank accession: | NM_003021 |
| Immunogen: | SGTA (NP_003012.1, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPA |
| Protein accession: | NP_003012.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to SGTA on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |