SCG5 monoclonal antibody (M02), clone 8G11 View larger

SCG5 monoclonal antibody (M02), clone 8G11

H00006447-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCG5 monoclonal antibody (M02), clone 8G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SCG5 monoclonal antibody (M02), clone 8G11

Brand: Abnova
Reference: H00006447-M02
Product name: SCG5 monoclonal antibody (M02), clone 8G11
Product description: Mouse monoclonal antibody raised against a partial recombinant SCG5.
Clone: 8G11
Isotype: IgG2a Kappa
Gene id: 6447
Gene name: SCG5
Gene alias: 7B2|P7B2|SGNE1|SgV
Gene description: secretogranin V (7B2 protein)
Genbank accession: NM_003020
Immunogen: SCG5 (NP_003011, 59 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGL
Protein accession: NP_003011
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006447-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006447-M02-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged SCG5 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: {alpha}-melanocyte-stimulating Hormone Inhibits TNF-{alpha}-stimulated MUC5AC Expression in Human Nasal Epithelial Cells.Lee SN, Ryu JH, Joo JH, Choi YH, Lee HJ, Kim YJ, Kim KB, Yoon JH.
Am J Respir Cell Mol Biol. 2010 Jul 16. [Epub ahead of print]

Reviews

Buy SCG5 monoclonal antibody (M02), clone 8G11 now

Add to cart