SGK monoclonal antibody (M03), clone 1C4 View larger

SGK monoclonal antibody (M03), clone 1C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SGK monoclonal antibody (M03), clone 1C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re

More info about SGK monoclonal antibody (M03), clone 1C4

Brand: Abnova
Reference: H00006446-M03
Product name: SGK monoclonal antibody (M03), clone 1C4
Product description: Mouse monoclonal antibody raised against a partial recombinant SGK.
Clone: 1C4
Isotype: IgG2b Kappa
Gene id: 6446
Gene name: SGK1
Gene alias: SGK
Gene description: serum/glucocorticoid regulated kinase 1
Genbank accession: BC001263
Immunogen: SGK (AAH01263, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSN
Protein accession: AAH01263
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006446-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006446-M03-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SGK monoclonal antibody (M03), clone 1C4 now

Add to cart