Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00006442-M01 |
Product name: | SGCA monoclonal antibody (M01), clone 3C4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SGCA. |
Clone: | 3C4 |
Isotype: | IgG2b Kappa |
Gene id: | 6442 |
Gene name: | SGCA |
Gene alias: | 50-DAG|A2|ADL|DAG2|DMDA2|LGMD2D|SCARMD1|adhalin |
Gene description: | sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein) |
Genbank accession: | NM_000023 |
Immunogen: | SGCA (NP_000014.1, 26 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLP |
Protein accession: | NP_000014.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SGCA expression in transfected 293T cell line by SGCA monoclonal antibody (M01), clone 3C4. Lane 1: SGCA transfected lysate(42.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |