Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SFTPC monoclonal antibody (M01), clone 4A10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about SFTPC monoclonal antibody (M01), clone 4A10
| Brand: | Abnova |
| Reference: | H00006440-M01 |
| Product name: | SFTPC monoclonal antibody (M01), clone 4A10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SFTPC. |
| Clone: | 4A10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6440 |
| Gene name: | SFTPC |
| Gene alias: | PSP-C|SFTP2|SMDP2|SP-C |
| Gene description: | surfactant protein C |
| Genbank accession: | BC005913 |
| Immunogen: | SFTPC (AAH05913, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDVGSKEVLMESPPDYSAAPRGRFGIPRCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI |
| Protein accession: | AAH05913 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (47.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SFTPC is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of a bone marrow-derived epithelial-like population capable of repopulating injured mouse airway epithelium.Wong AP, Keating A, Lu WY, Duchesneau P, Wang X, Sacher A, Hu J, Waddell TK. J Clin Invest. 2009 Feb;119(2):336-48. doi: 10.1172/JCI36882. Epub 2009 Jan 26. |