SFTPC MaxPab mouse polyclonal antibody (B01) View larger

SFTPC MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SFTPC MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SFTPC MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00006440-B01
Product name: SFTPC MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human SFTPC protein.
Gene id: 6440
Gene name: SFTPC
Gene alias: PSP-C|SFTP2|SMDP2|SP-C
Gene description: surfactant protein C
Genbank accession: NM_003018
Immunogen: SFTPC (NP_003009, 1 a.a. ~ 197 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI
Protein accession: NP_003009
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006440-B01-13-15-1.jpg
Application image note: Western Blot analysis of SFTPC expression in transfected 293T cell line (H00006440-T01) by SFTPC MaxPab polyclonal antibody.

Lane 1: SFTPC transfected lysate(21.67 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SFTPC MaxPab mouse polyclonal antibody (B01) now

Add to cart