SFTPB monoclonal antibody (M01), clone 1H7 View larger

SFTPB monoclonal antibody (M01), clone 1H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SFTPB monoclonal antibody (M01), clone 1H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re,WB-Tr

More info about SFTPB monoclonal antibody (M01), clone 1H7

Brand: Abnova
Reference: H00006439-M01
Product name: SFTPB monoclonal antibody (M01), clone 1H7
Product description: Mouse monoclonal antibody raised against a full-length recombinant SFTPB.
Clone: 1H7
Isotype: IgG2a Kappa
Gene id: 6439
Gene name: SFTPB
Gene alias: PSP-B|SFTB3|SFTP3|SMDP1|SP-B
Gene description: surfactant protein B
Genbank accession: NM_000542.2
Immunogen: SFTPB (NP_000533.2, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Protein accession: NP_000533.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006439-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (68.5 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006439-M01-2-A6-1.jpg
Application image note: SFTPB monoclonal antibody (M01), clone 1H7. Western Blot analysis of SFTPB expression in human lung cancer.
Applications: WB-Ti,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SFTPB monoclonal antibody (M01), clone 1H7 now

Add to cart