Brand: | Abnova |
Reference: | H00006439-D01 |
Product name: | SFTPB MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human SFTPB protein. |
Gene id: | 6439 |
Gene name: | SFTPB |
Gene alias: | PSP-B|SFTB3|SFTP3|SMDP1|SP-B |
Gene description: | surfactant protein B |
Genbank accession: | NM_000542.2 |
Immunogen: | SFTPB (NP_000533.2, 1 a.a. ~ 381 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL |
Protein accession: | NP_000533.2 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SFTPB MaxPab rabbit polyclonal antibody. Western Blot analysis of SFTPB expression in human pancreas. |
Applications: | WB-Ti,WB-Tr,IP |
Shipping condition: | Dry Ice |