Cart 3 Product Products 290,01 € (empty)
No products
To be determined Shipping
290,01 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 290,01 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 290,01 €
Data sheet of SFRS7 purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about SFRS7 purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00006432-B02P |
| Product name: | SFRS7 purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SFRS7 protein. |
| Gene id: | 6432 |
| Gene name: | SFRS7 |
| Gene alias: | 9G8|AAG3 |
| Gene description: | splicing factor, arginine/serine-rich 7, 35kDa |
| Genbank accession: | NM_001031684 |
| Immunogen: | SFRS7 (NP_001026854.1, 1 a.a. ~ 238 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD |
| Protein accession: | NP_001026854.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SFRS7 expression in transfected 293T cell line by SFRS7 MaxPab polyclonal antibody. Lane 1: SFRS7 transfected lysate(26.18 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |