Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00006432-B02P |
Product name: | SFRS7 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human SFRS7 protein. |
Gene id: | 6432 |
Gene name: | SFRS7 |
Gene alias: | 9G8|AAG3 |
Gene description: | splicing factor, arginine/serine-rich 7, 35kDa |
Genbank accession: | NM_001031684 |
Immunogen: | SFRS7 (NP_001026854.1, 1 a.a. ~ 238 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD |
Protein accession: | NP_001026854.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SFRS7 expression in transfected 293T cell line by SFRS7 MaxPab polyclonal antibody. Lane 1: SFRS7 transfected lysate(26.18 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |