SFRS6 monoclonal antibody (M02), clone 5G6 View larger

SFRS6 monoclonal antibody (M02), clone 5G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SFRS6 monoclonal antibody (M02), clone 5G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about SFRS6 monoclonal antibody (M02), clone 5G6

Brand: Abnova
Reference: H00006431-M02
Product name: SFRS6 monoclonal antibody (M02), clone 5G6
Product description: Mouse monoclonal antibody raised against a partial recombinant SFRS6.
Clone: 5G6
Isotype: IgG2b Kappa
Gene id: 6431
Gene name: SFRS6
Gene alias: B52|FLJ08061|MGC5045|SRP55
Gene description: splicing factor, arginine/serine-rich 6
Genbank accession: NM_006275
Immunogen: SFRS6 (NP_006266, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR
Protein accession: NP_006266
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006431-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006431-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SFRS6 is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SFRS6 monoclonal antibody (M02), clone 5G6 now

Add to cart