Brand: | Abnova |
Reference: | H00006428-M06A |
Product name: | SFRS3 monoclonal antibody (M06A), clone 1C8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SFRS3. |
Clone: | 1C8 |
Isotype: | IgG3 Kappa |
Gene id: | 6428 |
Gene name: | SFRS3 |
Gene alias: | SRp20 |
Gene description: | splicing factor, arginine/serine-rich 3 |
Genbank accession: | NM_003017 |
Immunogen: | SFRS3 (NP_003008, 1 a.a. ~ 85 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEK |
Protein accession: | NP_003008 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.09 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SFRS3 monoclonal antibody (M06A), clone 1C8. Western Blot analysis of SFRS3 expression in K-562(Cat # L009V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |