Cart 3 Product Products 290,01 € (empty)
No products
To be determined Shipping
290,01 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 290,01 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 290,01 €
Data sheet of SFRS2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about SFRS2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00006427-B01P |
| Product name: | SFRS2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SFRS2 protein. |
| Gene id: | 6427 |
| Gene name: | SFRS2 |
| Gene alias: | PR264|SC-35|SC35|SFRS2A|SRp30b |
| Gene description: | splicing factor, arginine/serine-rich 2 |
| Genbank accession: | BC066958 |
| Immunogen: | SFRS2 (AAH66958, 1 a.a. ~ 179 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGADPGVGAVPGLAADLATAARSLGPALVLDLGRPPSPDPHEGPSPSPRRSPDLVRGPGPGLGPGVLPQCPRGNPNPGRDRRVPPSLLKRKERCPLKKMLRSPV |
| Protein accession: | AAH66958 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SFRS2 expression in transfected 293T cell line (H00006427-T01) by SFRS2 MaxPab polyclonal antibody. Lane 1: SFRS2 transfected lysate(19.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |