Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SFRP4 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about SFRP4 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00006424-A01 |
| Product name: | SFRP4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SFRP4. |
| Gene id: | 6424 |
| Gene name: | SFRP4 |
| Gene alias: | FRP-4|FRPHE|MGC26498 |
| Gene description: | secreted frizzled-related protein 4 |
| Genbank accession: | NM_003014.2 |
| Immunogen: | SFRP4 (NP_003005.1, 211 a.a. ~ 312 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | CNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSN |
| Protein accession: | NP_003005.1 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SFRP4 expression in transfected 293T cell line by SFRP4 polyclonal antibody (A01). Lane1:SFRP4 transfected lysate(40 KDa). Lane2:Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Loss of secreted frizzled-related protein 4 correlates with an aggressive phenotype and predicts poor outcome in ovarian cancer patients.Jacob F, Ukegjini K, Nixdorf S, Ford CE, Olivier J, Caduff R, Scurry JP, Guertler R, Hornung D, Mueller R, Fink DA, Hacker NF, Heinzelmann-Schwarz VA. PLoS One. 2012;7(2):e31885. Epub 2012 Feb 21. |