Brand: | Abnova |
Reference: | H00006421-M01 |
Product name: | SFPQ monoclonal antibody (M01), clone 3B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SFPQ. |
Clone: | 3B10 |
Isotype: | IgG2a Kappa |
Gene id: | 6421 |
Gene name: | SFPQ |
Gene alias: | POMP100|PSF |
Gene description: | splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated) |
Genbank accession: | NM_005066 |
Immunogen: | SFPQ (NP_005057, 269 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ |
Protein accession: | NP_005057 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.97 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SFPQ monoclonal antibody (M01), clone 3B10. Western Blot analysis of SFPQ expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |