Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SFPQ polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SFPQ polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00006421-A01 |
| Product name: | SFPQ polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SFPQ. |
| Gene id: | 6421 |
| Gene name: | SFPQ |
| Gene alias: | POMP100|PSF |
| Gene description: | splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated) |
| Genbank accession: | NM_005066 |
| Immunogen: | SFPQ (NP_005057, 269 a.a. ~ 361 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ |
| Protein accession: | NP_005057 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | TRAP150 interacts with the RNA-binding domain of PSF and antagonizes splicing of numerous PSF-target genes in T cells.Christopher A. Yarosh, Iulia Tapescu, Matthew G. Thompson, Jinsong Qiu, Michael J. Mallory, Xiang-Dong Fu and Kristen W. Lynch. Nucleic Acid Research. 2015 |