Brand: | Abnova |
Reference: | H00006396-M02 |
Product name: | SEC13 monoclonal antibody (M02), clone 1G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SEC13. |
Clone: | 1G7 |
Isotype: | IgG2a Kappa |
Gene id: | 6396 |
Gene name: | SEC13 |
Gene alias: | D3S1231E|SEC13L1|SEC13R|npp-20 |
Gene description: | SEC13 homolog (S. cerevisiae) |
Genbank accession: | NM_030673 |
Immunogen: | SEC13 (NP_109598, 226 a.a. ~ 324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNE |
Protein accession: | NP_109598 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SEC13 is 0.03 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |