Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SEC13 monoclonal antibody (M02), clone 1G7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,IP |
More info about SEC13 monoclonal antibody (M02), clone 1G7
| Brand: | Abnova |
| Reference: | H00006396-M02 |
| Product name: | SEC13 monoclonal antibody (M02), clone 1G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SEC13. |
| Clone: | 1G7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6396 |
| Gene name: | SEC13 |
| Gene alias: | D3S1231E|SEC13L1|SEC13R|npp-20 |
| Gene description: | SEC13 homolog (S. cerevisiae) |
| Genbank accession: | NM_030673 |
| Immunogen: | SEC13 (NP_109598, 226 a.a. ~ 324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNE |
| Protein accession: | NP_109598 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SEC13 is 0.03 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,IP |
| Shipping condition: | Dry Ice |