Cart 28 Product Products 2 706,76 € (empty)
No products
To be determined Shipping
2 706,76 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 28 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 706,76 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 706,76 €
Data sheet of SDHB purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,WB-Tr |
More info about SDHB purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00006390-D01P |
| Product name: | SDHB purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human SDHB protein. |
| Gene id: | 6390 |
| Gene name: | SDHB |
| Gene alias: | FLJ92337|IP|PGL4|SDH|SDH1|SDHIP |
| Gene description: | succinate dehydrogenase complex, subunit B, iron sulfur (Ip) |
| Genbank accession: | BC007840.2 |
| Immunogen: | SDHB (NP_002991.2, 1 a.a. ~ 280 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV |
| Protein accession: | NP_002991.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SDHB MaxPab rabbit polyclonal antibody. Western Blot analysis of SDHB expression in human kidney. |
| Applications: | WB-Ce,WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |