Brand: | Abnova |
Reference: | H00006387-M01 |
Product name: | CXCL12 monoclonal antibody (M01), clone 1E5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CXCL12. |
Clone: | 1E5 |
Isotype: | IgG2b Kappa |
Gene id: | 6387 |
Gene name: | CXCL12 |
Gene alias: | PBSF|SCYB12|SDF-1a|SDF-1b|SDF1|SDF1A|SDF1B|TLSF-a|TLSF-b|TPAR1 |
Gene description: | chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) |
Genbank accession: | BC039893 |
Immunogen: | CXCL12 (AAH39893.1, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
Protein accession: | AAH39893.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CXCL12 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |